Easy care: EasyCare сервис поиска домработниц, нянь и специалистов по уходу за пожилыми людьми

Работа сиделкой/домработницей в Москве | вакансии сиделок и домработниц от прямых работодателей, частные объявления.

Найти работу сиделкой или домработницей в Москве кажется непростой задачей, ведь спрос в мегаполисе часто превышает предложение. Ищете работу сиделкой или домработницей в Москве - наш сервис призван помочь соискателям.

Вакансии сиделки/домработницы

Работа сиделкой сопряжена с большой ответственностью и вместе с тем профессия, на которой взаимодействие с людьми выходит на первый план, приносит реальную пользу обществу и позволяет проявить себя. Если вы чувствуете в себе желание помогать людям, и у вас есть подходящий опыт, то предлагаем вам изучить частные объявления о работе сиделкой в Москве от прямых работодателей.

Сиделка на дому чаще всего требуется для ухода за пожилым человеком, который не может самостоятельно обслуживать себя. Также услуги сиделки могут потребоваться семье, в которой родственник имеет временно ограниченную подвижность или не дееспособен. Как правило, требуются женщины, но есть вакансии сиделки от частных лиц и для мужчин.

В задачи помощницы на дому, как правило, входит:

  • базовый гигиенический уход за подопечным;
  • покупка продуктов, приготовление еды;
  • смена нательного и постельного белья;
  • проведение медицинских процедур;
  • сопровождение подопечного на прогулку и по делам.

Почему EasyCare?

Мы предлагаем удобный поиск работы сиделки без посредников в Москве и Московской области. У нас большая база вакансий сиделки, свежие вакансии ежедневно. Чтобы получить доступ к объявлениям от прямых работодателей и иметь возможность откликнуться на них, зарегистрируйтесь и максимально подробно заполните анкету работника, указав свои контакты. Размещение фотографий и рекомендаций от предыдущих работодателей значительно увеличит ваши шансы на успех.

Регулярно просматривайте объявления, и тогда срочная работа сиделки может стать вашей. Поиск по фильтрам позволит найти работу рядом с домом. Узнайте прямо сейчас, сколько нанимателей интересуется услугами сиделки.

Отделка «Easy Care»

Лицо компании во многом определяет корпоративная одежда, которую носят ее сотрудники. Но как сделать правильный выбор спецодежды из многообразия, которое сегодня предлагает российский рынок? Как помочь клиенту, который ищет оптимальное решение для себя или персонала целой компании? Ведь при выборе одежды очень важно, чтобы костюм был красивым и опрятным, а главное, служил не месяц-другой, а год и более (в соответствии с Нормами или ТУ компании).

Зачастую  клиенту приходится сталкиваться с рядом  проблем в процессе эксплуатации изделий:

  • потеря формы изделия – выглядит как мешок;
  • складки и заломы после промышленных стирок;
  • образование пиллинга - «катышек», которые так портят внешний вид костюма и сотрудника;
  • потеря размера -  изделие либо садится, либо растягивается по ширине/длине;
  • быстрый выход костюма из строя и затраты на его ремонт.

Отделка «Easy Care» - серьезное преимущество!

Многие потребители уже знают, что одежда из тканей от Carrington надежна и долговечна, надолго сохраняет презентабельный внешний вид и способна подчеркнуть высокий статус предприятия. Так благодаря чему это достигается?

 пппСерьезным преимуществом всех тканей от Carrington служит финальная отделка «Easy care» («Легкий уход»), влияющая на увеличение срока эксплуатации готового изделия, на протяжении которого полностью сохраняется его презентабельный вид!

Отделка «Easy Care» - высокотехнологичная отделка текстильных материалов особыми nano-препаратами, напрямую влияющих на потребительские свойства готовой одежды:



  • Несминаемость - теперь не будет заломов после стирки!
  • Быстрое восстановление после смятия - больше не нужно гладить после стирки (до 85°С) и сушки!
  • Отсутствие усадки - отделка способствует снижению показателей усадки!
  • Устойчивость к пиллингу - попрощайтесь с надоевшими катышками!
  • Экологичность - нет формальдегида,  не вызывает аллергии!
  • Прочность - гарантия долговечности изделия!

Благодаря финальной отделке «Easy Care», спецодежду можно носить до 3-х лет и она будет полностью отвечать высоким требованиям к фирменной спецодежде (как внешне, так и по прочностным характеристикам).

ВАЖНО!

При производстве тканей с отделкой «Easy Care» используется сбалансированный состав препаратов  нового поколения на NANO основе, что придает ткани оптимальные потребительские свойства, не ухудшая ее прочностные характеристики. Этого можно добиться лишь в условиях  высокотехнологичного производства, используя альянс современной химии, новейшее оборудование и контроль качества высшей степени автоматизации.

Базовые технологии, применяемые на сегодняшний день для аналогичной отделки другими производителями, НЕ обеспечивают необходимую экологичность, прочность и износоустойчивость ткани при многократной эксплуатации из-за влияния применяемых препаратов на ее механические свойства.

Лучше один раз увидеть!

С целью наглядной демонстрации работы отделки «Easy Care» в 2014 году в собственной лаборатории Carrington были организованы сравнительные испытания ткани ТОМБОЙ (TOMBOY, Carrington), Российской и Китайской «подделок»:

1.Испытание на устойчивость тканей к промышленной высокотемпературной стирке (5 стирок и сушек).
Визуально оцениваются: заломы, формоустойчивость, стойкость цвета (фото 1). 2.Испытание на устойчивость ткани к образованию пиллинга (после 5 стирок и сушек).
По пятибалльной шкале на специальном оборудовании, после 7000 циклов (фото 2).

Ткань ТОМБОЙ
отделка «Easy Care»
 Ткань – Российская «подделка» Ткань – Китайская «подделка»

Фото 1. Лаборатория Carrington, испытание на устойчивость тканей к промышленной высокотемпературной стирке.

ТОМБОЙ:    5 баллов                Китайская «подделка»: 2-3 балла  Российская «подделка»: 3 балла

Фото 2. Лаборатория Carrington, испытание на устойчивость тканей к пиллингу.

Проведенные испытания наглядно доказали, что изначальный внешний вид изделия,  заявленные характеристики и свойства имеют, по сути, второстепенное значение. А в первую очередь, важна их сохранность и стабильность после промышленных стирок и интенсивной носки, ведь они напрямую влияют на внешний вид сотрудника на предприятии.

Результаты испытаний подтвердили, что отделка «Easy Care» гарантирует изделиям из тканей безупречный внешний вид в процессе интенсивной эксплуатации на протяжении нескольких лет, чего НЕ могут обеспечить ни российские, ни китайские ткани.

Особенности спецодежды из тканей c отделкой «Easy Care»

Благодаря инновационным решениям, Вы забудете о дополнительных хлопотах и негативных откликах, поскольку одежда из тканей с отделкой «Easy Care»:

  • Гарантирует предприятию безупречный внешний вид сотрудников на протяжении всего срока носки спецодежды.

  • Помогает сократить издержки на сложный уход, ремонт и преждевременную замену некачественных изделий.

  • Избавляет от затрат на дорогостоящие процедуры глажения (изделия из тканей с отделкой «Easy Care» не нужно гладить после стирки и сушки).
Ткани с отделкой «Easy Care» высокоэкологичны, гипоаллергенны, соответствуют требованиям международного стандарта Oeko-Tex®, гарантирующего безопасность для здоровья текстильной продукции всех видов.
  

Приталенная рубашка Easy Care (3 шт)

Такой комплект – выгодное предложение для тех, кто заботится о своем внешнем виде. Приталенный крой рубашек – модный тренд сезона. Инновационная технология Easy Care позволяет легко ухаживать за вещами

- Вид

: мужская рубашка

- Крой: приталенный

- Застёжка: пуговицы до низа

- Длина рукава: длинный

- Вид воротника: классический

- Одна пуговица на рукаве

- Фиксированные пластинки в углу воротника

- Количество карманов: 1

- Легко гладится

- С антибактериальным эффектом

Состав

- 65% полиэстер, 35% хлопок

Рекомендации по уходу

- Машинная стирка при 30º, машинная сушка

Какой способ доставки Вы предпочитаете?

Просим Вас обратить внимание: официальный интернет магазин Marks & Spencer в России предлагает все возможные способы доставки для Вашего удобства.

Расположив способы доставки в порядке возрастания стоимости, получим список:

  • Почта России
  • Доставка в пункт выдачи заказов
  • Доставка курьером до двери

Способы оплаты

Оплатить заказ можно удобным для Вас способом: на сайте или при получении. Доступные способы оплаты: банковской картой или наличными. Подарочные карты для оплаты заказов не принимаются.

Оплата наличными

Оплата заказа наличными осуществляется при получении заказа от курьера, в пункте выдачи заказов или в почтовом отделении.

Оплата банковской картой

Оплата заказа банковской картой осуществляется на сайте при оформлении заказа. Так же заказ можно оплатить банковской картой при получении товара у курьера или в пунктах выдачи заказа только при наличии у них такой технической возможности.

При производстве продукции Marks & Spencer соблюдаются самые высокие стандарты качества для того, чтобы вещь прослужила Вам долго и дарила максимальный комфорт в использовании.

Если покупка не соответствует Вашим ожиданиям, Вы можете осуществить обмен или возврат удобным для Вас способом.

EasyCare | Sadolin

Описание продукта

Матовая акриловая краска для стен, с прекрасной устойчивостью к мытью, для внутренних работ (класс 1 устойчивости к мокрому истиранию, ISO 11998). Продукт содержит воск, который делает окрашенную поверхность стойкой к воздействию жидкости и загрязнений. Благодаря специальному гидрофобному покрытию краски EasyCare попавшая на поверхность жидкость (например, прохладительные напитки, соки) не впитывается в основу, а остается на поверхности в виде капель. Малая контактная площадь между каплей и базовой поверхностью снижает риск загрязнения и значительно упрощает чистку поверхности. Краска EasyCare не образует брызг, легко наносится и равномерно разравнивается, образуя гладкую поверхность.

Продукт практически не имеет запаха и колеруется в широкой цветовой гамме. Высокая устойчивость акриловой краски к истиранию на многие годы обеспечивает поверхность, за которой легко ухаживать.

Как наносить?

Для финишной отделки поверхности используйте краску EasyCare. Перед использованием продукт необходимо тщательно перемешать. Краску наносят на поверхность в 2 слоя валиком или кистью, давая поверхности высохнуть в соответствии с требованиями в промежутке между нанесением слоев. Краска готова к употреблению и не нуждается в разбавлении. При разбавлении краски или нанесении на поверхность более тонкого слоя, чем требуется, могут ухудшиться водо- и грязеотталкивающие свойства поверхности. При нанесении на поверхность более тонкого слоя краски, чем требуется, водооталкивающие свойства продукта могут не проявиться в полной мере. При окрашивании стен краску наносить на поверхность сначала в поперечном направлении, а затем выровнять поверхность движениями валика вверх-вниз. Каждое последнее движение валика по полосе краски выполнить по всей высоте стены в одном направлении. При окрашивании потолков работать в направлении падения света, т.е. разравнивающие мазки делать в направлении от окна. При обычных условиях краска приобретает первичную водоотталкивающую (гидрофобную) защиту в течение 1–2 недель после окрашивания, поэтому рекомендуется избегать очистки окрашенной поверхности до истечения указанного срока. В случае если окрашенная поверхность нуждается в более ранней чистке, то чистить ее следует осторожно, используя влажную тряпку. Для чистки загрязненной красочной поверхности можно использовать чуть теплую воду и мягкую тряпку из микрофибры или тряпку для мытья. Не использовать абразивные инструменты и средства, жесткую губку или щетку с жесткой щетиной. Водоотталкивающие свойства окрашенной поверхности восстанавливаются, как правило, в течение 5–7 дней после чистки поверхности влажной тряпкой, однако это все же зависит как от использованного средства или рабочего инструмента, интенсивности мытья, так и от степени загрязненности поверхности.

Гигиена труда и техника безопасности

Предупреждения об опасности

Хранить в недоступном для детей месте. Работать в хорошо вентилируемом помещении и избегать попадания химиката на кожу и в глаза. В случае проглатывания химиката незамедлительно обратиться к врачу.

Средство по уходу за террасной доской Easy Care 2,5 л в Москве

1

Наша компания является официальным дилером всех торговых марок, представленных в нашем ассортименте. Все торговые марки проверены временем. Мы уверены в качестве и надёжности предлагаемой продукции. В последнее время появилась хорошая тенденция – всё больше поставщиков имеют в своём штате Технолога.

2

Внимательно читайте инструкции на упаковках! Так вы избавите себя от проблем, связанных с неправильной укладкой.

Общие правила возврата товара.

3

Возврат товара осуществляется согласно Закону о защите прав потребителя, в течение 14 календарных дней с момента отгрузки и подписания товарной накладной. К возврату принимаются только невскрытые, неповреждённые, чистые упаковки.

4

Претензии, связанные с внешним видом товара (товар повреждён, нарушена заводская упаковка), принимаются только в процессе приёмки товара покупателем или доверенным лицом покупателя. После подписания товарной накладной товар считается принятым покупателем и претензии к внешнему виду не принимаются.

5

Вы вскрыли упаковку напольного или настенного покрытия, и вам кажется, что товар некачественный, не тот дизайн, или существуют
какие-либо другие сомнения? Не вскрывайте остальные упаковки! Срочно позвоните нам по любому телефону, указанному на сайте, и
сообщите о возникшей проблеме. Чтобы помочь вам в данной ситуации, нам потребуется от вас некоторая информация – в первую очередь,
фото- или видеоматериалы.
На них должны присутствовать:
- ярлыки с упаковок, а также серийный фабричный номер на обратной стороне пластины.
- вероятная проблема.
На основании данных материалов мы сделаем вывод о необходимости выезда представителя нашей компании или представителя
производителя к вам на объект и дадим рекомендации о дальнейших действиях.
Если подтвердится факт брака, наша компания осуществит самовывоз всей партии такого товара. В дальнейшем по согласованию с
покупателем мы либо возвращаем оплату, либо осуществляем замену на такой же качественный товар или товар с альтернативным дизайном и
характеристиками

6

К возврату не принимается:
- товар, изготовленный по индивидуальному заказу.
- клея, лаки, масла и прочая химия.

Оформление возврата лишнего товара

7

Что делать, если возврат осуществляется из другого города? Возможны два варианта:
- транспортные расходы, связанные с возвратом качественного товара, оплачиваются покупателем
- транспортные расходы, связанные с возвратом некачественного товара, оплачиваются продавцом или производителем.

EasyCare Паровой утюг GC3593/35 | Philips

EasyCare Паровой утюг GC3593/35 | Philips

EasyCare

Паровой утюг

GC3593/35

Великолепные результаты благодаря мощности 2400 Вт

Мощный утюг от Philips с самой надежной подошвой. Ничто не может поцарапать ее во время глажения. Интенсивный паровой удар помогает с легкостью разгладить любые складки. Узнать обо всех преимуществах

К сожалению, этот продукт больше не доступен

Если вы имеете право на льготы по НДС для медицинских устройств, вы можете воспользоваться ими при покупке этого продукта. НДС будет вычтен из цены, указанной выше. Подробную информацию см. в корзине.

EasyCare Паровой утюг

Великолепные результаты благодаря мощности 2400 Вт

Мощный утюг от Philips с самой надежной подошвой. Ничто не может поцарапать ее во время глажения. Интенсивный паровой удар помогает с легкостью разгладить любые складки. Узнать обо всех преимуществах

Великолепные результаты благодаря мощности 2400 Вт

Мощный утюг от Philips с самой надежной подошвой. Ничто не может поцарапать ее во время глажения. Интенсивный паровой удар помогает с легкостью разгладить любые складки. Узнать обо всех преимуществах

К сожалению, этот продукт больше не доступен

Если вы имеете право на льготы по НДС для медицинских устройств, вы можете воспользоваться ими при покупке этого продукта. НДС будет вычтен из цены, указанной выше. Подробную информацию см. в корзине.

EasyCare Паровой утюг

Великолепные результаты благодаря мощности 2400 Вт

Мощный утюг от Philips с самой надежной подошвой. Ничто не может поцарапать ее во время глажения. Интенсивный паровой удар помогает с легкостью разгладить любые складки. Узнать обо всех преимуществах

Великолепные результаты благодаря мощности 2400 Вт

С устойчивой к царапинам подошвой Anodilium

  • Система автоотключения
  • Подошва Anodilium
  • Металлический носик
  • 2400 Вт

Паровой носик Steam Tip позволяет прогладить труднодоступные детали одежды

Уникальный носик подошвы утюга Philips со специальными удлиненными отверстиями позволяет пару проникать в самые труднодоступные складки и эффективно разглаживать даже мелкие элементы одежды.

Система "капля-стоп" предотвращает протекание воды на одежду

Этот паровой утюг Philips оснащен системой "капля-стоп", поэтому вы сможете гладить даже деликатные ткани при низкой температуре, не беспокоясь о появлении пятен воды на одежды.

Прочная подошва Anodilium устойчива к повреждениям

Превосходное скольжение, великолепная защита от механических повреждений, удобная очистка, долгий срок службы!

Автоотключение в 3 случаях

Утюг отключается автоматически, если он в течение 30 секунд неподвижно лежит на подошве, 30 секунд лежит на боку или стоит вертикально в течение 8 минут.

Мягкая ручка для комфорта при длительном глажении

Мягкая ручка утюга Philips обеспечивает удобство использования даже при длительном глажении.

Показать все функции Показать меньше функций

Показать все Функции устройства Показать меньше Функции устройства

Технические характеристики

  • Быстрое и мощное разглаживание складок

    Подошва

    Anodilium

    Постоянная подача пара

    40 г/мин

    Паровой удар

    150 г

    Вертикальное отпаривание

    Да

    Настройка подачи пара

    Да

    Распылитель

    Да

    Паровой носик

    Да

    Питание

    2400 Вт

  • Легко использовать

    Объем резервуара для воды

    300 мл

    Заполнение и опустошение резервуара для воды

    Большое отверстие для залива воды

    Система "капля-стоп"

    Да

    Мягкая ручка

    Да

    Система автоотключения

    Да

    Отделение для хранения шнура

    Фиксатор шнура

    Длина шнура питания

    2,5 м

    Свободный поворот шнура (шарнир)

    Свободный поворот шнура на 360 градусов

  • Очистка от накипи

    Можно использовать водопроводную воду

    Да

    Очистка от накипи

    Двойная очистка от накипи

  • Технические характеристики

    напряжение

    220–240 В

  • Вес и габариты

    Размеры изделия (Ш x В x Д)

    32,8 x 12,9 x 16,3 см

    Масса утюга

    1,64 кг

Просмотреть все спецификации См. Меньше спецификаций

Показать все Технические характеристики Показать меньше Технические характеристики

Предлагаемые продукты
Недавно просмотренные продукты

{{{sitetextsObj.prominentRating}}}

написать отзыв

{{{sitetextsObj.totalReview}}} {{{sitetextsObj.recommendPercentage}}}

    {{#each ratingBreakdown}}
  • {{ratingValue}} Только отзывы с оценкой {{ratingValue}} зв.
  • {{/each}}

написать отзыв

    {{#each userReviews}}
  • {{this.UserNickname}} {{date this.SubmissionTime ../this.dateFormat}}

    {{#if this.Badges}} {{#if this.Badges.incentivizedReview}}

    Часть продвижения Этот рецензент получил вознаграждение за написание этого обзора. Вознаграждение может быть купоном, образцом продукта, билетом на участие в розыгрыше, баллами лояльности или иным ценным призом, выдаваемым за написание обзора на этот продукт.

    {{/if}} {{#if this.Badges.Expert}}

    Мнение эксперта Этот отзыв был написан экспертом индустрии после тестирования продукта, предоставленного Philips

    {{/if}} {{/if}}

    {{this.Title}}

    {{this.ReviewText}}

    {{#if this.IsRecommended}}

    Да, я рекомендую этот продукт

    {{/if}}
  • {{/each}}
{{this.UserNickname}} {{#with ContextDataValues}}
    {{#iff Gender 'and' Gender.Value}} {{#iff Gender.Value 'eq' 'Male'}}
  • мужчина
  • {{/iff}} {{#iff Gender.Value 'eq' 'Female'}}
  • Женщина
  • {{/iff}} {{/iff}}{{#iff Age 'and' Age.ValueLabel}}
  • Возраст  {{Age.ValueLabel}}
  • {{/iff}}{{#iff HowManyPeopleLiveInYourHousehold 'and' HowManyPeopleLiveInYourHousehold. ValueLabel}}
  • {{{replaceString 'Членов семьи: {number}' '{number}' HowManyPeopleLiveInYourHousehold.ValueLabel}}}
  • {{/iff}}
  • {{{replaceString 'Голосов: {number}' '{number}' ../TotalFeedbackCount}}}
{{/with}} {{date this.SubmissionTime ../this.dateFormat}} {{#if this.Badges}} {{#if this.Badges.verifiedPurchaser}}

Проверенный покупатель

{{/if}} {{#if this.Badges.incentivizedReview}}

Часть продвижения Этот рецензент получил вознаграждение за написание этого обзора. Вознаграждение может быть купоном, образцом продукта, билетом на участие в розыгрыше, баллами лояльности или иным ценным призом, выдаваемым за написание обзора на этот продукт.

{{/if}} {{#if this.Badges.Expert}}

Мнение эксперта Этот отзыв был написан экспертом индустрии после тестирования продукта, предоставленного Philips

{{/if}} {{/if}}

{{this.Title}}

{{this.ReviewText}}

{{#if this.IsRecommended}}

Да, я рекомендую этот продукт

{{/if}} {{#if this.AdditionalFields.Pros}} {{#with this.AdditionalFields.Pros}}

Достоинства:

{{Value}}

{{/with}} {{/if}}{{#if this.AdditionalFields.Cons}} {{#with this.AdditionalFields.Cons}}

Недостатки:

{{Value}}

{{/with}} {{/if}} {{#iff Photos.length 'or' Videos.length}}
    {{#each Videos}} {{#if VideoId}}
  • {{#if VideoThumbnailUrl}} {{else}} {{/if}}
  • {{/if}} {{/each}}{{#each Photos}} {{#iff Sizes 'and' Sizes.normal}} {{#if Sizes.normal.Url}}
  • {{/if}} {{/iff}} {{/each}}
{{/iff}}{{#if IsSyndicated}} {{#iff SyndicationSource 'and' SyndicationSource.Name}}

{{{replaceString 'Оригинальная запись на {domain}' '{domain}' SyndicationSource. Name}}}

{{/iff}} {{/if}}{{#if this.ClientResponses}} {{#each this.ClientResponses}}

Ответ от Philips

{{Department}} {{date Date ../../../dateFormat}}

{{Response}}

{{/each}} {{/if}}

Был ли этот отзыв полезен? Да / Нет

Да • {{TotalPositiveFeedbackCount}} Нет • {{TotalNegativeFeedbackCount}}

Вы действительно хотите сообщить о нарушении правил этим пользователем? Сообщить / Отмена

{{/each}} {{/if}} {{/iff}} {{#iff @key "eq" 'phone'}} {{#if this.phoneFlag}} {{/if}} {{/iff}} {{#iff @key "eq" 'email'}} {{#if this.emailFlag}} Послать эл. письмо {{/if}} {{/iff}} {{#iff @key "eq" 'social'}} {{#if this.whatsappFlag}} {{/if}} {{#if this.socialFlag}} {{#this}} {{#iff type "eq" 'link'}} {{/iff}}{{#iff type "eq" 'content'}} {{/iff}} {{#iff type "eq" 'script'}} {{this.label}} {{!-- Issue with Chat link due to google+ script, so commenting the same. --}} {{!--

{{{this.content}}}

--}} {{/iff}} {{/this}} {{/if}} {{/iff}} {{/each}} {{/if}} {{/iff}} {{#iff @key "eq" 'phone'}} {{#if this.phoneFlag}} {{/if}} {{/iff}} {{#iff @key "eq" 'myPhilips'}} {{#if this.myPhilipsFlag}} {{/if}} {{/iff}} {{/each}}

Выбранные продукты (0/3)

  • Добавить продукт

  • Добавить продукт

  • Добавить продукт

  • Добавить продукт

  • Рубашки easy care в Ставрополе

    Меня зовут Елена. Я имидж консультант сети салонов «Престиж». Сегодня мы поговорим о рубашках легкой глажки изикеа. Образ делового человека предполагает наличие костюма из добротной ткани и конечно же идеально выглаженной рубашки. Если уход за костюмом решается с помощью химчисток, то уход за рубашками превращается для мужчины в настоящую проблему. Потому что это ежедневные стирки и глажки.

    Иногда кажется, что конца и края нет этим мятым рубашкам. Но прогресс не стоит на месте. И для рубашек нашлось решение. Представляем вам новый способ быть всегда на высоте. Рубашки итальянского бренда Марио Мачарди легкой глажки изикеа. Обращайте внимание на этикетку. Так что же это за волшебные рубашки изикеа? Это рубашки, которые обработаны на уровне волокна с помощью специальных современных технологий. Кроме этого, рубашки из 100% качественного хлопка, но в отличие от обычных рубашек такая рубашка не нуждается в длительной глажке. Достаточно ее погладить 1-2 минуты. Затем, в течение дня она прекрасно сохраняет форму, отлично садится и не мнется. То есть в конце дня эта рубашка выглядит свежей, как будто только что из-под утюга. Это основное преимущество сорочек изикеа перед обычными хлопковыми рубашками. Немнущиеся рубашки изикеа сэкономят ваши силы и время, которые вы бы потратили на разглаживание обычных хлопковых рубашек. Они очень удобны в командировках, в поездках. 

    Эти рубашки добавляют в глазах окружающих вам статус. Даже если вы не гладите сами, рубашки изикеа сэкономят нервы, время вашей жены, что покажет вашу заботу о ней. Как это работает. Для того чтобы рубашки изикеа действительно облегчили вашу жизнь соблюдайте несколько простых правил ухода. Во-первых такие рубашки нужно стирать в режиме ручной стирки при оборотах отжима не больше 300 – 400. Не использовать ополаскиватель, стирать только порошком. После того как вы постирали нужно встряхнуть рубашку, повесить ее на плечики, застегнуть верхнюю пуговицу до высыхания. После этого вы можете ее слегка прогладить. Глажка займет буквально 1 -2 минуты. Надеваете эту рубашку и идете по своим делам. Меняйте свою жизнь к лучшему вместе с сорочками от Марио Мачарди с обработкой изикеа. Ждем вас в наших салонах


    http://men26.ru/catalog/sorochki-i-rubashki/sorochki-ne-trebuyushchie-glazhki/

    Наш youtube канал https://www.youtube.com/channel/UCd4iFGMwgbKcuVHG74Y5AZw

    Наш инстаграм @prestige.stv

    Оригинальный Easyboot

    Есть вопрос, на который здесь нет ответа? Пожалуйста, свяжитесь с нами для получения дополнительной информации.

    Q В чем разница между Easyboot и Easyboot Epic?

    A Ботинки такие же, но Epic поставляется с установленным на заводе чехлом Easyboot Gaiter.

    Q Можно ли обновить Easyboot до Easyboot Epic?

    А Да. Все ботинки Easyboot, произведенные после января 2005 года, можно обновить до Easyboot Epic. Просто купите и установите Easyboot Gaiter на любую Easyboot, произведенную после января 2005 года.

    Q Как я могу определить, произведен ли мой Easyboot после января 2005 г.?

    A Быстрый и простой способ подтвердить дату производства 2005 г. или более позднюю - поискать логотип лошади Easyboot на задней части ботинка.

    Q Вы оставляете Easyboots включенными все время?

    A Нет. Пусть лошадь гуляет босиком как можно чаще. Используйте Easyboots только тогда, когда лошади нужна защита ног или сцепление. Не оставляйте Easyboots на лошади дольше 12 часов за раз.

    Q Подходят ли ботинки Easyboots для снега и льда?

    А Да.Полиуретановая поверхность Easyboot предотвращает образование снежных комков на нижней части ботинка, как на подошве лошади в стандартной обуви. Доступны дополнительные шпильки с титановым покрытием для захвата листового льда.

    Q Попадут ли песок и гравий в багажник?

    А Да. Небольшое количество песка может попасть внутрь, но, как правило, недостаточно, чтобы причинить вред. Обращайтесь с Easyboot, как со своей спортивной обувью, время от времени очищайте ее! Обращайтесь с Easyboot, как со своей спортивной обувью, время от времени очищайте ее! Вы также можете надеть на лошадь колокол, чтобы не допустить попадания мусора.

    Q Увеличивает ли износ Easyboot при ношении Easyboot поверх железной обуви?

    А Да. Хотя Easyboot можно носить поверх стальной обуви в различных ситуациях, износ Easyboot увеличивается при установке поверх обуви и аннулирует гарантию EasyCare.

    Q Обеспечат ли Easyboots хорошее сцепление с дорогой?

    А Да. Они обеспечивают надежную опору для лошади и безопасность всадника. Кованые лошади могут быть опасны на тротуаре. Легкие ботинки предотвращают скольжение. Из них получится отличная парадная обувь и они уменьшают удары по мощеным покрытиям.

    QПри таком разнообразии формы копыт, как можно гарантировать хорошую посадку?

    A Самый важный фактор успеха Easyboots - это правильный размер. Измерьте копыто, сравните с таблицей размеров и выберите размер в соответствии с указанными диапазонами. После того, как вы выбрали правильный размер для своей лошади, ее можно адаптировать к большинству нормальных вариантов копыт. Если форма копыт вашей лошади более чем на один размер отличается от «стандартной» формы (ширина по сравнению с длиной), показанной в таблице, Easyboot может быть не лучшим выбором для вашего приложения.

    QКаков прогнозируемый срок службы Easyboot?

    A Ваш «пробег», конечно, будет зависеть от ряда факторов. Как часто ты катаешься? Вы едете по асфальту или грязи 30 минут или 10 миль? Сапоги одних лошадей могут показывать износ на носке, а сапоги другого могут указывать на износ с внутренней стороны. Независимо от того, как движется ваша лошадь, Easyboots превосходит металлическую подкову, а также обеспечивает страховку от травм.

    Q Экономичны ли ботинки Easyboots?

    А Да.С Easyboots отпадает необходимость в обуви. Тщательно протестированные на пересеченной местности и длительных поездках, пересеченной местности и асфальте, Easyboot износостойкость стальной обуви по крайней мере 3: 1 превосходит износостойкость стальной обуви с запасом хода более 500 миль. Владельцы лошадей сообщают о более чем 1000 миль на одну обувь.

    Easyboot Epic

    Есть вопрос, на который здесь нет ответа? Пожалуйста, свяжитесь с нами для получения дополнительной информации.

    Q Вам нужны подковы в дополнение к Easyboot Epic?

    № Easyboot Epics обеспечивает полную защиту копыт и сцепление с ними.Их также можно носить поверх обычной обуви, но это аннулирует гарантию EasyCare.

    Q В чем разница между Easyboot и Easyboot Epic?

    A Ботинки такие же, но Easyboot Epic поставляется с установленными на заводе гетрами Easyboot и низкопрофильным ремнем Comfort Strap.

    Q Можно ли оставлять Easyboot Epics постоянно включенной?

    A Нет. Лучше всего отпускать лошадь босиком как можно чаще. Используйте Easyboot Epics только тогда, когда лошади нужна защита ног или сцепление.Не оставляйте Easyboot Epics на лошади дольше 12 часов за раз.

    Q Подходит ли Easyboot Epics для снега и льда?

    А Да. Полиуретановая поверхность Easyboot Epics предотвращает образование снежных комков на нижней части ботинка, как это было бы на подошве лошади в стандартной обуви. Доступны дополнительные шпильки с титановым покрытием для захвата листового льда.

    Q Попадут ли песок и гравий в багажник?

    А Да. Небольшое количество песка может попасть внутрь, но, как правило, недостаточно, чтобы причинить вред.Обращайтесь с Easyboot Epic как со своей спортивной обувью, время от времени очищайте ее!

    Q Увеличивает ли износ Easyboot Epic надевание Easyboot Epics поверх железной обуви?

    А Да. Хотя Easyboot Epics можно носить поверх стальной обуви в различных ситуациях, износ Easyboot Epic увеличивается при надевании поверх обуви и аннулирует гарантию EasyCare.

    Q Будет ли Easyboot Epics обеспечивать хорошее сцепление с дорогой?

    А Да. Они обеспечивают надежную опору для лошади и безопасность всадника.Кованые лошади могут быть опасны на тротуаре. Easyboot Epics предотвращает скольжение. Из них получится отличная парадная обувь и они уменьшают удары по мощеным покрытиям.

    Q Нужно ли обрезать копыто лошади?

    A Всем лошадям необходима правильная программа стрижки копыт, независимо от того, босиком они или подкованы. По любым вопросам или проблемам, связанным с обрезкой копыт, обращайтесь к своему специалисту по уходу за копытами.

    Q Как можно гарантировать хорошее прилегание при таком разнообразии формы копыт?

    A Самый важный фактор успеха Easyboot Epics - это правильный размер.Измерьте копыто, сравните с таблицей размеров и выберите размер в соответствии с указанными диапазонами. После того, как вы выбрали правильный размер для своей лошади, ее можно адаптировать к большинству нормальных вариантов копыт. Если форма копыт вашей лошади более чем на один размер отличается от «стандартной» формы (ширина и длина), показанной на диаграмме, Easyboot Epic может быть не лучшим выбором для вашего приложения.

    Q Каков предполагаемый срок службы Easyboot Epic?

    A Ваш «пробег», конечно, будет зависеть от ряда факторов.Как часто ты катаешься? Вы едете по асфальту или грязи 30 минут или 10 миль? Сапоги одних лошадей могут показывать износ на носке, в то время как другие могут указывать на износ внутри. Независимо от того, как движется ваша лошадь, Easyboot Epics превосходит металлическую подкову, а также обеспечивает страховку от травм.

    Q Экономичны ли Easyboot Epics?

    А Да. С Easyboot Epics отпадает необходимость в обуви. Тщательно протестированные на пересеченной местности и длительных поездках, пересеченной местности и асфальте, Easyboot износостойкость стальной обуви по крайней мере 3: 1 превосходит износостойкость стальной обуви с запасом хода более 500 миль. Владельцы лошадей сообщают о более чем 1000 миль на одну обувь.

    Q Могу ли я использовать систему Therapy Click System с этой загрузкой?

    А Да. EasyBoot Epic совместим с системой Therapy Click System.

    EasyCare Inc.

    Страна:

    [Выберите] ОРГАНИЗАЦИЯ STATESAFGHANISTANLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA И BARBUDAARGENTINAARMENIAARUBAAUSTRALIAAUSTRIAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIABOSNIA И HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH ИНДИЙСКИЙ ОКЕАН TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL АФРИКАНСКИЕ REPUBLICCHADCHILECHINACOLOMBIACOMOROSCONGOCONGO, ДЕМОКРАТИЧЕСКАЯ РЕСПУБЛИКА THECOOK ISLANDSCOSTA RICACOTE D'IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND (Мальвинские) острова ФАРЕРСКИЕ ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH POLYNESIAGABONGAMBIAGEORGIAGERMANYGHANAGIBRALTARGREECEGREENLANDGRENADAGUADELOUPEGUAMGUATEMALAGUINEAGUINEA-BISSAUGUYANAHAITIHEARD ОСТРОВ И МАКДОНАЛЬД ISLANDSHOLY SEE (ГОРОД ВАТИКАН) ГОНДУРАШОНГ КОНГХУНГРИИ МИК РЕСПУБЛИКА OFIRAQIRELANDISRAELITALYJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA ДЕМОКРАТИЧЕСКАЯ НАРОДНАЯ РЕСПУБЛИКА OFKOREA, РЕСПУБЛИКА OFKUWAITKYRGYZSTANLAO НАРОДНАЯ ДЕМОКРАТИЧЕСКАЯ REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN АРАБСКИЕ JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBOURGMACAOMACEDONIA, бывшая югославская Республика OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, Федеративные Штаты OFMOLDOVA, РЕСПУБЛИКА OFMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANEW ZEALANDNICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT Киттс и NEVISSAINT LUCIASAINT VINCENT И GRENADINESSAMOASAN MARINOSAO TOME И ПРИНЦИПЕСАУДИ-АРАБИЯENEGALSERBIASERBIA И ЧЕЛЛЕССЕРБА И ЧЕЛЛЕССИЕРРА-ЛЕОНЕСИНГАПОРЕСЛОВАКИАСЛОВЕНИИ NDSSOMALIASOUTH AFRICASOUTH ГРУЗИЯ И Южные Сандвичевы ISLANDSSPAINSRI LANKASUDANSURINAMESWAZILANDSWEDENSWITZERLANDSYRIAN АРАБ REPUBLICTAIWANTAJIKISTANTANZANIA, Объединенная Республика OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD И TOBAGOTUNISIATURKEYTURKMENISTANTURKS И КАЙКОС ISLANDSTUVALUUGANDAUKRAINEUNITED АРАБ EMIRATESUNITED KINGDOMUNITED Внешние малые острова ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN, BRITISHVIRGIN ОСТРОВА, У. С.ЙЕМЕНЗАМБИАЗИМБАБВЕ

    Обзор гарантии

    EasyCare | Привод

    Обзор гарантии EasyCare

    Благодаря широкому набору вариантов обслуживания автомобилей EasyCare потребители могут либо выбрать план, который соответствует их потребностям, либо настроить его так, чтобы он идеально подходил.

    EasyCare предлагает широкий выбор вариантов покрытия для личного и коммерческого рынка, от базовых вариантов покрытия, ориентированных на такие вещи, как вмятины и ремонт кузовных панелей, до гарантий на бампер, которые покрывают почти все на транспортном средстве.Ниже приведены несколько наиболее популярных планов EasyCare, которые помогут вам лучше понять, что они предлагают.

    • Договоры на обслуживание транспортных средств. EasyCare предоставляет комплексные контракты на обслуживание автомобилей с четырьмя различными уровнями покрытия. Мы обсуждаем каждый ниже:
    1. TOTALCARE : Это наиболее полный пакет. Это фактически похоже на заводскую гарантию от бампера до бампера, охватывающую весь автомобиль.
    2. STATEDCARE : На ступеньку ниже от TOTALCARE, этот пакет охватывает все необходимое, включая электрическую систему, подвеску и рулевое управление, а также все, что предусмотрено в планах более низкого уровня.
    3. ПЕРВИЧНОЕ ОБСЛУЖИВАНИЕ : Этот план охватывает большинство основных компонентов, от трансмиссии до топливной и тормозной систем. Однако электрическая система, подвеска и рулевое управление не включены в покрытие.
    4. POWERCARE : Этот план обеспечивает базовое покрытие трансмиссии и является наиболее доступным среди планов EasyCare.
    • Покрытие жилых автофургонов. Владельцы автофургонов также могут получить полную защиту от бампера до бампера через EasyCare.Подобно планам обслуживания транспортных средств, упомянутым выше, план EasyCare RV включает круглосуточную помощь на дороге, выбор ремонтного предприятия и покрытие прерывания поездки, чтобы покрыть вашу еду, проживание, возмещение арендного автомобиля или другие расходы, которые вы можете понести после аварии или поломки. .

    Кроме того, EasyCare также предлагает различные дополнения к уже упомянутым вариантам полного покрытия. Они включают, помимо прочего, предоплаченное обслуживание, защиту от кражи, защиту внешнего вида, ремонт вмятин, уход за ключами и многое другое.

    Затраты по гарантии

    Учитывая, что EasyCare не детализирует стоимость различных планов, которые они предлагают, будет сложно дать точную разбивку затрат, но из нашего исследования мы знаем, что затраты могут варьироваться от От 100 до 500 долларов в год, в зависимости от выбранного вами плана и надстроек. Мы видели, как некоторые дилеры, сотрудничающие с EasyCare, предлагают наиболее полный контракт EasyCare всего за 2095 долларов США на 5 лет покрытия. Вы можете приобрести гарантийный план напрямую, позвонив в EasyCare, или обратиться к ближайшему к вам дилеру.

    Узнать больше о том, сколько на самом деле стоит продленная гарантия на автомобиль, можно здесь.

    Вещи, которые нам нравятся

    Варианты покрытия EasyCare могут понравиться многим, и самое лучшее в этом провайдере гарантии - это огромное разнообразие предлагаемых планов. Действительно, набор гарантийных планов EasyCare привлечет владельцев автомобилей с любым бюджетом. Независимо от того, хотите ли вы покрыть каждый дюйм своего автомобиля, EasyCare найдет для вас идеальный план.Более того, вы также можете настроить свой план с помощью широкого набора надстроек EasyCare, таких как помощь на дороге, замена ключей, замена лобового стекла и многое другое.

    Еще одна вещь, которая нам понравилась в EasyCare, - это то, что они включают множество льгот в некоторые из своих планов. Вы можете получить круглосуточную помощь на дороге и страхование прерывания поездки, чтобы покрыть расходы на питание, проживание или буксировку в случае аварии или поломки. Кроме того, вы можете передать страховое покрытие следующему владельцу, если решите продать свой автомобиль, увеличив его стоимость на рынке.

    EasyCare также является одним из немногих поставщиков контрактов на обслуживание транспортных средств, который предлагает различные планы покрытия поездок, чтобы защитить водителей поездок от необходимости оплачивать крупные личные расходы в случае аварии, что делает их одним из наиболее всеобъемлющих. поставщики гарантии на рынке.

    Конечно, тот факт, что EasyCare работает более 30 лет и получила рейтинг A + от Better Business Bureau, - это еще одна вещь, которая нам нравится, так как это многое говорит об их стремлении предоставлять качественные гарантийные услуги.

    Вещи, которые нам не нравятся

    Ключевые детали планов EasyCare отсутствуют на их веб-сайте, поэтому получить точную разбивку затрат непросто. Информация об ограничениях страхового покрытия в зависимости от возраста автомобиля также явно отсутствует.

    Мы надеялись получить дополнительную информацию о планах EasyCare на их веб-сайте, но, похоже, единственный способ получить точную разбивку затрат - это поговорить с дилером или позвонить в центр обслуживания клиентов EasyCare.

    Часто задаваемые вопросы

    В. На что распространяется гарантия EasyCare?

    Это будет зависеть от типа выбранного вами гарантийного договора на автомобиль. Самый полный план EasyCare, TOTALCARE, в основном сопоставим с заводской гарантией от бампера до бампера и покрывает каждый дюйм автомобиля, за исключением таких вещей, как косметические повреждения и техническое обслуживание. Самый доступный план EasyCare, POWERCARE, охватывает важнейшие части трансмиссии и является отличным планом для старых автомобилей со сниженной стоимостью при перепродаже.Помимо четырех видов контрактов на обслуживание транспортных средств EasyCare, это дополнительные услуги, такие как защита от кражи, прерывание поездки, замена ключей и многое другое.

    В. Как мне отменить гарантию EasyCare?

    Процесс расторжения договора о расширенной гарантии с EasyCare прост и может быть выполнен в любое время, но вступление в силу может занять до пяти рабочих дней. Вы можете расторгнуть договор, поговорив с дилерским центром, который продал вам план, или с брокером, если вы не получили план в дилерском центре.

    Отзывы клиентов EasyCare

    Является ли EasyCare подходящим поставщиком гарантии за ваши деньги? Прежде чем принять решение, всегда полезно узнать, что другие сказали о своем опыте работы с EasyCare.

    «Отличный сервис, без этого покрытия мы бы не обошлись! У нас была пара дорогостоящих ремонтов, и это окупилось ». - Венди М. через ConsumerAdvocate

    «Я много езжу по работе, 50 000 миль в год. Когда я купил свой Subaru Legacy 2017 года в Cochran Subaru в Монровилле, Па был предложен бампер Easy Care 150k к бамперу, и я вложил в него деньги.Примерно 140 км в моей трансмиссии начало капризничать. Я взял его, и они дали мне взаймы. Менее чем через неделю мой Subaru получил новую трансмиссию, что сэкономило мне 6500 долларов! Излишне говорить, что я очень верю в расширенные гарантии и Easy Care и получу их снова на моем следующем Subaru, который я куплю в следующем году. Спасибо Easy Care и сервису Cochran Subaru !! » Хуан Д. через ConsumerAdvocate

    «Я работаю с Easy Care с 1994 года (через 10 лет после создания) в качестве финансового директора автосалона, я НЕ буду покупать автомобиль без этого покрытия, как и мои друзья и семья.Да, не закрывают шланги, вещи выходят из строя (пока не вышли из строя), обслуживаются. предметы, но они НАМНОГО ЛУЧШЕЕ покрытие на рынке !!! Они платят полную розничную стоимость в сертифицированной ремонтной мастерской, они платят кредитной картой, поэтому оплата происходит мгновенно, жалобы, которые я читал о помощи на дороге, это не Easy Care, которая является компанией, которая сдает в субаренду RSA. Убедитесь и попросите заключить договор Total Care, другие покрывают меньше и не покрывают так же всесторонне. Если у вас никогда не было претензий и вы чувствуете, что «потратили впустую» деньги, вам повезло, что у вас не было 16 000 долларов на ремонт, как я видел на ОДНОМ автомобиле !!! У меня четвертый контракт на обслуживание нашего Silverado 2008 года, я использовал его только дважды для решения той же проблемы, которая возникла в третьем контракте.Но я не жалуюсь, я бы предпочел иметь спокойствие, что у меня не будет ремонта трансмиссии за 5000 долларов или замены двигателя за 8000 долларов! Спасибо Easy Care, я ценю те миллионы долларов, которые вы потратили с 1984 года ». - Келли Г. через ConsumerAdvocate

    «Это ваша типичная гарантийная компания, которая дает все обещания, чтобы заставить вас купить их продукт. Затем, когда у вас действительно возникнет проблема, и вы попросите их решить ее, они ответят: «О, это не покрывается гарантией».Владел своим кемпером менее 1 года, и они не покрывали ничего, с чем у меня были проблемы, они даже пытались сказать, что я порвал тент, и поэтому они не собирались его покрывать. Верно, я залез на свой кемпер, чтобы разорвать свою задвижку, которая использовалась только 3 раза с тех пор, как я купил фургон. Эти парни - пустая трата времени и денег, экономят ваши деньги и требуют лучшего !!!! » - Вилли В. через BBB

    Стоит ли план гарантии EasyCare?

    В конечном итоге вопрос о том, стоит ли продленная гарантия на автомобиль, решать вам.Но мы определенно чувствуем, что гарантия EasyCare будет стоить своих денег, тем более что у них есть широкий ассортимент продуктов, которые подходят для любого типа бюджета. Как мы уже упоминали, EasyCare существует более 30 лет. Они имеют хорошую репутацию благодаря тому, что с ними легко иметь дело, и благодаря быстрому выполнению работ. Если вы хотите приобрести план расширенной гарантии, мы рекомендуем вам ознакомиться с ними.

    Дополнительная информация

    Вот еще несколько ресурсов, которые вы можете использовать:

    13 Простые в уходе растения | HGTV

    Лаванда английская (Lavandula angustifolia)

    Tough поставляется в красивой упаковке с оттенком английской лаванды.Эта средиземноморская трава придает аромат цветкам и серебристым листьям. Английская лаванда может образовывать ароматную живую изгородь. В небольших садах попробуйте компактный сорт, например Munstead или Thumbelina Leigh.

    Львиный хвост (Leonotis leonurus)

    Цвет позднего сезона - это то, что вы получите, если добавите в свой сад устойчивый к оленям львиный хвост.Осенью дебютируют темно-оранжевые цветы, напоминающие маленькие пушистые шарики. В зонах, свободных от заморозков, это высокий кустарниковый многолетник, вырастающий до 4-8 футов. В районах с морозом он ведет себя как многолетнее растение, достигая высоты 4 футов и умирая на зиму на земле. Соедините его с английской лавандой, чтобы получилась привлекательная комбинация.

    ‘Denver Daisy’ Rudbeckia hirta

    Эта грубая рудбекия - потрясающее зрелище, она распускает двухцветные цветы от середины лета до морозов.Большие цветы имеют диаметр от 6 до 8 дюймов и имеют коричневые центры, окруженные красно-коричневым ореолом и золотыми лепестками. Стебли крепкие - это необходимо при срезке садов.

    Лоропетал "Purple Pixie"

    Красочный и беззаботный, лоропетал поднимает сады на новый уровень благодаря своей современной плакучей форме и темно-бордовым вечнозеленым листьям.Весной появляются розовые цветы. Это небольшой кустарник высотой от 1 до 2 футов. Используйте его на посадочной грядке или положите в контейнер высотой 2 фута или выше, чтобы продемонстрировать его плачущий стиль. Loropetalum не содержит вредных организмов и устойчив к засухе.

    Солодка мята (Agastache rupestris)

    Сажайте солодку мяту для получения разноцветных цветочных шипов, которые манят колибри, бабочек, пчел и других опылителей.Все растение имеет ароматы лакрицы и мяты. Цветки апельсина прорастают из основания лаванды, создавая яркую сцену в саду. Светится посаженный овсяницей голубой. Он также устойчив к оленям и засухе.

    Герань "Rozanne"

    Подарите своему саду непрерывные фиолетово-синие цветы с белыми серединками, посадив герань «Rozanne».Эта симпатичная девушка создает холмик из стеблей, которые, если их оставить в покое, карабкаются по грядке от весны до мороза. Или сделайте стрижку, чтобы она оставалась на месте по мере прохождения сезона. Лучше всего растет там, где летом прохладно, и не требует особого ухода.

    Покровный цветок (Gaillardia x grandiflora)

    Цветы, похожие на ромашки, покрывают этот задорный многолетник, добавляя ярких и веселых оттенков летнему саду.Покрывной цветок устойчив к оленям, засухе и кроликам, привлекает бабочек и прекрасно себя чувствует в летнюю жару. Ищите сорта с цветами золотых, красных и всех промежуточных оттенков. Показанный сорт «Апельсины и лимоны».

    Мексиканский кустовой шалфей "Санта-Барбара" (Salvia leucantha)

    Этот стойкий как ногти многолетник - настоящая достопримечательность с пурпурными цветочными шипами, которые возвышаются над листьями серого тона.«Санта-Барбара» - более компактный сорт, высотой от 2 до 3 футов. Это любимец бабочек, который придает яркость осеннему саду. Соедините его с львиным хвостом, чтобы получить эффектное зрелище в конце сезона.

    Коралловые колокола (Гейчера)

    Добавьте немного цвета на солнце, чтобы затемнить участки растений яркими листьями коралловых колокольчиков.Эта группа растений предлагает практически любой оттенок: от ярко-оранжевого до неоново-лаймового и почти черного. Многие разновидности оживляют двухцветный дизайн. Используйте их для кромки грядок или заполнения контейнеров. Они часто сопротивляются оленям и всегда беззаботны.

    Хризантемы

    Украсьте свой пейзаж поздним летом и осенью надежной игрой садовых мам с маленькими цветочками.Вы можете выбрать цветы радуги оттенков, включая белый, красный, золотой, розовый, ржавый и бордовый. Этот многолетник надежен, неприхотлив в уходе и вносит большой вклад в осенний цвет.

    «Маргарита БОП» Предгорье Пенстемон

    В своих родных окрестностях ожидайте, что этот потрясающий уроженец Калифорнии будет цвести круглый год, если вы продолжаете подрезать потраченные цветы.Он окутывает сад истинно синими цветами, которые манят бабочек и колибри. «BOP» означает «нижняя часть крыльца», где питомник обнаружил, что растет этот драгоценный камень. Он морозостойкий в зонах с 6 по 10, хотя может не цвести постоянно в более прохладных регионах.

    Coprosma Гибриды

    Откройте для себя красоту этого новозеландского кустарника, который отличается низким ростом и блестящими листьями.Он представлен во множестве цветовых комбинаций. «Tequila Sunrise» - это желтый, изумрудно-зеленый и темно-оранжевый цвет, а «Evening Glow» - это зеленые и золотые листья, которые осенью полируются до оранжево-красных. «Rainbow Surprise» - это смесь красного, зеленого и розового на листьях.

    Дымовое дерево (Cotinus)

    Несмотря на название, дымчатое дерево на самом деле больше похоже на куст, хотя многие садовники воспитывают его как маленькое деревце.Цветы блекнут, образуя удивительные розовые или пурпурные шлейфы, напоминающие клубы дыма, плывущие среди ветвей. Летом дымится, создавая потрясающий пейзажный вид. Листья почти пурпурные. Существует несколько разновидностей; Отображается «Милость».

    Легкий уход | Пряжа | Мэйфлауэр

    Easy Care - это классическая шерстяная пряжа из 100% мериносовой шерсти от датского производителя пряжи Mayflower.Пряжа невероятно мягкая, а поскольку она сделана из шерсти мериноса, она не царапается и с ней приятно работать. Easy Care доступен во впечатляющей цветовой гамме с множеством красивых цветов, от более приглушенных до неоновых - так что определенно найдется цвет, который подойдет вашему проекту.

    Помимо того, что шерсть очень удобна для кожи, она подвергается супер-стирке, что делает ее очень полезной для повседневного использования, особенно для детской и детской одежды, поскольку она выдерживает стирку шерсти в машине при 40 ° C (104 ° C). F) и сушить в стиральной машине при низких температурах.

    Важная информация: В соответствии со специальными правилами ЕС производителям пряжи не разрешается писать шерсть мериноса под содержимым ленты мяча, но мы гарантируем, что пряжа на 100% состоит из шерсти мериноса.

    Найдите выкройки для пряжи здесь: Выкройки (9)

    Пат

    Вчера вечером я начала делать небольшой детский кардиган с 010.Ой, какая это мягкая и красивая пряжа. Вскоре я вижу, что заказываю больше, даже подумал, что заказал 3 мяча 3-х разных цветов.


    Рон

    Я очень доволен этой пряжей. Он красивый и мягкий, красивые цвета, я сделала из него 3 шарфа; один для меня и два других для подарков. Я заказал еще и с нетерпением жду его!


    Самира

    Я только что получил свою посылку.ُ Пряжа очень мягкая, и я очень рад начать свой новый проект.


    Робин

    Сделал из этих мотков три шапочки, и они получились красивыми. Не сильно зудит!


    Николь

    Буду заказывать еще !! Такой красивый цвет !!


    Делитесь фотографиями готовых проектов с помощью Easy Care
    Помогите другим найти правильную пряжу для своего следующего проекта.
    Поделитесь фотографиями блузок, шапок, варежек и т. Д., Которые вы связали или связаны крючком из этой пряжи.

    Когда вы загружаете изображение на Hobbii, вы также подтверждаете, что обладаете авторскими правами на изображение и предоставляете Hobbii право использовать изображение для маркетинга на своих собственных и внешних веб-сайтах, включая социальные сети.

    Easy Care Classic | Пряжа | Мэйфлауэр

    Easy Care Classic - это классическая шерстяная пряжа из 100% новой мериносовой шерсти от датского производителя пряжи Mayflower.Он доступен во впечатляющей цветовой гамме с множеством красивых и четких цветов, разумеется, для вашего проекта определенно найдется цвет.

    Помимо того, что шерсть очень удобна для кожи, она подвергается супер-стирке, что делает ее очень полезной для повседневного использования, особенно для детской и детской одежды, поскольку она выдерживает стирку шерсти в машине при 40 ° C (104 ° F) и сушить в стиральной машине при низких температурах.

    Найдите выкройки для пряжи здесь: Выкройки (2)

    Джойс Шелли

    Мне нравится ощущение этой шерсти мериноса.Он мягкий и не трескается, когда я вяжу крючком. Не могу дождаться, когда мой внук наденет свой новый свитер. Спасибо!


    Мелани

    Довольно удивлен качеством этой пряжи. Я только начала грелку для шеи и с нетерпением жду возможности носить эту мягкую пряжу.


    Обри

    Я сшила из этой пряжи кардиган и получилось красиво! Он был мягким и не рассыпался по всей поверхности.


    Франсин ШМИДТ

    Красиво мягкая шерсть! И отличное соотношение цены и качества для Мерино! С нетерпением жду начала своего проекта! 👍🏻😀


    Ханна

    Очень просто работать! Быстро вяжется, особенно из 2-х прядей.


    Обменивайтесь фотографиями готовых проектов с помощью Easy Care Classic
    Помогите другим найти правильную пряжу для своего следующего проекта.
    Поделитесь фотографиями блузок, шапок, варежек и т. Д., Которые вы связали или связаны крючком из этой пряжи.

    Когда вы загружаете изображение на Hobbii, вы также подтверждаете, что обладаете авторскими правами на изображение и предоставляете Hobbii право использовать изображение для маркетинга на своих собственных и внешних веб-сайтах, включая социальные сети.